SCOPe 2.07: Domain d3uctb_: 3uct B:

Lineage for d3uctb_ (3uct B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (14 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47517] (106 PDB entries)
   Uniprot P02593

8. Domain d3uctb_: 3uct B: [233775]
   automated match to d3ucya_
   complexed with mn, zn

Details for d3uctb_

PDB Entry: 3uct, 1.9 Å

PDB Description: Structure of Mn2+-bound N-terminal domain of calmodulin in the presence of Zn2+

PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d3uctb_:

Sequence; same for both SEQRES and ATOM records:

>d3uctb_ a.39.1.5 (B:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmark

Timeline for d3uctb_:

• d3uctb_ first appeared in SCOPe 2.03
  
• d3uctb_ appears in SCOPe 2.06
  
• d3uctb_ appears in the current release, SCOPe 2.08