Lineage for d3u9pl2 (3u9p L:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761390Domain d3u9pl2: 3u9p L:108-212 [233774]
    Other proteins in same PDB: d3u9pc_, d3u9pd_
    automated match to d1l7tl2

Details for d3u9pl2

PDB Entry: 3u9p (more details), 2.8 Å

PDB Description: crystal structure of murine siderocalin in complex with an fab fragment
PDB Compounds: (L:) Monoclonal Fab Fragment Light Chain

SCOPe Domain Sequences for d3u9pl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u9pl2 b.1.1.0 (L:108-212) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsseqlatggasvvcfvnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkvdyerhnlytcevvhktssspvvksfnrn

SCOPe Domain Coordinates for d3u9pl2:

Click to download the PDB-style file with coordinates for d3u9pl2.
(The format of our PDB-style files is described here.)

Timeline for d3u9pl2: