SCOPe 2.08: Domain d3u9pl1: 3u9p L:1-107

Lineage for d3u9pl1 (3u9p L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)

8. Domain d3u9pl1: 3u9p L:1-107 [233773]
   Other proteins in same PDB: d3u9pc_, d3u9pd_
   automated match to d1l7tl1

Details for d3u9pl1

PDB Entry: 3u9p, 2.8 Å

PDB Description: crystal structure of murine siderocalin in complex with an fab fragment

PDB Compounds: (L:) Monoclonal Fab Fragment Light Chain

SCOPe Domain Sequences for d3u9pl1:

Sequence; same for both SEQRES and ATOM records:

>d3u9pl1 b.1.1.0 (L:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dilmtqsplslsaslgdkvtitcqasqiiynyiawyqqkpgkaprllirytstlesgtps
rfsgsgsgrdysfsisnvesediasyyclqydnlpymfgagtklelk

Timeline for d3u9pl1:

• d3u9pl1 first appeared in SCOPe 2.03
  
• d3u9pl1 appears in SCOPe 2.07