Lineage for d3u9pm1 (3u9p M:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761391Domain d3u9pm1: 3u9p M:1-107 [233771]
    Other proteins in same PDB: d3u9pc_, d3u9pd_
    automated match to d1l7tl1

Details for d3u9pm1

PDB Entry: 3u9p (more details), 2.8 Å

PDB Description: crystal structure of murine siderocalin in complex with an fab fragment
PDB Compounds: (M:) Monoclonal Fab Fragment Light Chain

SCOPe Domain Sequences for d3u9pm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u9pm1 b.1.1.0 (M:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dilmtqsplslsaslgdkvtitcqasqiiynyiawyqqkpgkaprllirytstlesgtps
rfsgsgsgrdysfsisnvesediasyyclqydnlpymfgagtklelk

SCOPe Domain Coordinates for d3u9pm1:

Click to download the PDB-style file with coordinates for d3u9pm1.
(The format of our PDB-style files is described here.)

Timeline for d3u9pm1: