Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species uncultured organism [TaxId:155900] [233764] (1 PDB entry) |
Domain d3u3gb_: 3u3g B: [233766] automated match to d3h08b_ complexed with cl, unl |
PDB Entry: 3u3g (more details), 1.4 Å
SCOPe Domain Sequences for d3u3gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u3gb_ c.55.3.0 (B:) automated matches {uncultured organism [TaxId: 155900]} mnkiiiytdggargnpgpagigvvitdekgntlhessayigettnnvaeyealiraledl qmfgdklvdmevevrmdselivrqmqgvykvkeptlkekfakiahikmervpnlvfvhip reknaradelvneaidkals
Timeline for d3u3gb_: