SCOPe 2.04: Domain d3u1fb2: 3u1f B:607-767

Lineage for d3u1fb2 (3u1f B:607-767)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (7 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (4 PDB entries)

8. Domain d3u1fb2: 3u1f B:607-767 [233760]
   Other proteins in same PDB: d3u1fb1
   automated match to d3tunb2
   protein/RNA complex; complexed with 392, dms, gol, met

Details for d3u1fb2

PDB Entry: 3u1f, 2.2 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1392

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u1fb2:

Sequence; same for both SEQRES and ATOM records:

>d3u1fb2 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Timeline for d3u1fb2:

• d3u1fb2 first appeared in SCOPe 2.03
  
• d3u1fb2 does not appear in SCOPe 2.05