Lineage for d3u1fb1 (3u1f B:-4-373,B:387-606)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590900Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (5 PDB entries)
  8. 1590901Domain d3u1fb1: 3u1f B:-4-373,B:387-606 [233759]
    Other proteins in same PDB: d3u1fb2
    automated match to d3tunb1
    protein/RNA complex; complexed with 392, dms, gol, met

Details for d3u1fb1

PDB Entry: 3u1f (more details), 2.2 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1392
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u1fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u1fb1 c.26.1.0 (B:-4-373,B:387-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
gdiylgryegwysisdesfltpXckvslesghvvtwvseenymfrlsafrerllewyhan
pgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnylt
gsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkiv
ahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarln
gel

SCOPe Domain Coordinates for d3u1fb1:

Click to download the PDB-style file with coordinates for d3u1fb1.
(The format of our PDB-style files is described here.)

Timeline for d3u1fb1: