SCOPe 2.04: Domain d3u1fb1: 3u1f B:-4-373,B:387-606

Lineage for d3u1fb1 (3u1f B:-4-373,B:387-606)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (36 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (5 PDB entries)

8. Domain d3u1fb1: 3u1f B:-4-373,B:387-606 [233759]
   Other proteins in same PDB: d3u1fb2
   automated match to d3tunb1
   protein/RNA complex; complexed with 392, dms, gol, met

Details for d3u1fb1

PDB Entry: 3u1f, 2.2 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1392

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u1fb1:

Sequence; same for both SEQRES and ATOM records:

>d3u1fb1 c.26.1.0 (B:-4-373,B:387-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
gdiylgryegwysisdesfltpXckvslesghvvtwvseenymfrlsafrerllewyhan
pgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnylt
gsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkiv
ahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarln
gel

Timeline for d3u1fb1:

• d3u1fb1 first appeared in SCOPe 2.03
  
• d3u1fb1 does not appear in SCOPe 2.05