SCOPe 2.06: Domain d3tz2a1: 3tz2 A:39-185

Lineage for d3tz2a1 (3tz2 A:39-185)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.0: automated matches [230678] (1 protein)
   not a true family

6. Protein automated matches [230679] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries)

8. Domain d3tz2a1: 3tz2 A:39-185 [233757]
   automated match to d1gkza1
   complexed with clt

Details for d3tz2a1

PDB Entry: 3tz2, 2.85 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/phenylbutyrate complex

PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d3tz2a1:

Sequence; same for both SEQRES and ATOM records:

>d3tz2a1 a.29.5.0 (A:39-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhel
yirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvry
fldktltsrlgirmlathhlalhedkp

Timeline for d3tz2a1:

• d3tz2a1 first appeared in SCOPe 2.03
  
• d3tz2a1 appears in SCOPe 2.05
  
• d3tz2a1 appears in SCOPe 2.07
  
• d3tz2a1 appears in the current release, SCOPe 2.08