Lineage for d3tz2a1 (3tz2 A:39-185)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708719Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2708773Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 2708774Protein automated matches [230679] (2 species)
    not a true protein
  7. 2708789Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries)
  8. 2708801Domain d3tz2a1: 3tz2 A:39-185 [233757]
    Other proteins in same PDB: d3tz2a2
    automated match to d1gkza1
    complexed with clt

Details for d3tz2a1

PDB Entry: 3tz2 (more details), 2.85 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/phenylbutyrate complex
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d3tz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tz2a1 a.29.5.0 (A:39-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhel
yirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvry
fldktltsrlgirmlathhlalhedkp

SCOPe Domain Coordinates for d3tz2a1:

Click to download the PDB-style file with coordinates for d3tz2a1.
(The format of our PDB-style files is described here.)

Timeline for d3tz2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tz2a2