SCOPe 2.03: Domain d3twif_: 3twi F:

Lineage for d3twif_ (3twi F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (6 species)
   not a true protein

7. Species Petromyzon marinus [TaxId:7757] [231246] (5 PDB entries)

8. Domain d3twif_: 3twi F: [233751]
   automated match to d2o6ra_
   complexed with gol

Details for d3twif_

PDB Entry: 3twi, 2.55 Å

PDB Description: Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores

PDB Compounds: (F:) Variable lymphocyte receptor B

SCOPe Domain Sequences for d3twif_:

Sequence, based on SEQRES records:

>d3twif_ c.10.2.0 (F:) automated matches {Petromyzon marinus [TaxId: 7757]}
sqcscsgttvncqerslasvpagiptttqvlhlyinqitklepgvfdsltqltylnlavn
qltalpvgvfdkltklthlalhinqlksipmgvfdnlkslthiylfnnpwdcecsdilyl
knwivqhasivnplgnggvdnvkcsgtntpvravteastspskc

Sequence, based on observed residues (ATOM records):

>d3twif_ c.10.2.0 (F:) automated matches {Petromyzon marinus [TaxId: 7757]}
sqcscstvncqrslsvpptvlhlyinqitpgvltylnlavnqltalpvgvlthlalhinq
lsipmgvlthiylfnnpwecslyknwivqhasivnplgnggvdnvktntpvraveac

Timeline for d3twif_:

• d3twif_ is new in SCOPe 2.03-stable
  
• d3twif_ appears in SCOPe 2.04
  
• d3twif_ appears in the current release, SCOPe 2.08