SCOPe 2.04: Domain d3tvta2: 3tvt A:777-971

Lineage for d3tvta2 (3tvt A:777-971)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (8 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (5 PDB entries)

8. Domain d3tvta2: 3tvt A:777-971 [233749]
   Other proteins in same PDB: d3tvta1
   automated match to d1kjwa2

Details for d3tvta2

PDB Entry: 3tvt, 1.6 Å

PDB Description: structural basis for discs large interaction with pins

PDB Compounds: (A:) Disks large 1 tumor suppressor protein

SCOPe Domain Sequences for d3tvta2:

Sequence; same for both SEQRES and ATOM records:

>d3tvta2 c.37.1.1 (A:777-971) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vqrlsinytrpviilgplkdrinddliseypdkfgscvphttrpkreyevdgrdyhfvss
reqmerdiqnhlfieagqyndnlygtsvasvrevaekgkhcildvsgnaikrlqvaqlyp
vavfikpksvdsvmemnrrmteeqakktyeraikmeqefgeyftgvvqgdtieeiyskvk
smiwsqsgptiwvps

Timeline for d3tvta2:

• d3tvta2 first appeared in SCOPe 2.03
  
• d3tvta2 appears in SCOPe 2.05
  
• d3tvta2 appears in the current release, SCOPe 2.08