![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233746] (1 PDB entry) |
![]() | Domain d3tvta1: 3tvt A:602-776 [233747] Other proteins in same PDB: d3tvta2 automated match to d1kjwa1 |
PDB Entry: 3tvt (more details), 1.6 Å
SCOPe Domain Sequences for d3tvta1:
Sequence, based on SEQRES records: (download)
>d3tvta1 b.34.2.0 (A:602-776) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} slyvralfdydpnrddglpsrglpfkhgdilhvtnasddewwqarrvlgdnedeqigivp skrrwerkmrardrsvkseenvlsyea
>d3tvta1 b.34.2.0 (A:602-776) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} slyvralfdydpglpfkhgdilhvtnasddewwqarrvlgivpskrrwerkmravlsyea
Timeline for d3tvta1: