Lineage for d3tvta1 (3tvt A:602-776)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783435Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233746] (1 PDB entry)
  8. 2783436Domain d3tvta1: 3tvt A:602-776 [233747]
    Other proteins in same PDB: d3tvta2
    automated match to d1kjwa1

Details for d3tvta1

PDB Entry: 3tvt (more details), 1.6 Å

PDB Description: structural basis for discs large interaction with pins
PDB Compounds: (A:) Disks large 1 tumor suppressor protein

SCOPe Domain Sequences for d3tvta1:

Sequence, based on SEQRES records: (download)

>d3tvta1 b.34.2.0 (A:602-776) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slyvralfdydpnrddglpsrglpfkhgdilhvtnasddewwqarrvlgdnedeqigivp
skrrwerkmrardrsvkseenvlsyea

Sequence, based on observed residues (ATOM records): (download)

>d3tvta1 b.34.2.0 (A:602-776) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slyvralfdydpglpfkhgdilhvtnasddewwqarrvlgivpskrrwerkmravlsyea

SCOPe Domain Coordinates for d3tvta1:

Click to download the PDB-style file with coordinates for d3tvta1.
(The format of our PDB-style files is described here.)

Timeline for d3tvta1: