SCOPe 2.03: Domain d3tuid1: 3tui D:1-240

Lineage for d3tuid1 (3tui D:1-240)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein automated matches [190723] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [233742] (1 PDB entry)

8. Domain d3tuid1: 3tui D:1-240 [233743]
   Other proteins in same PDB: d3tuia_, d3tuib_, d3tuid2, d3tuie_, d3tuif_
   automated match to d3dhwc1
   complexed with adp

Details for d3tuid1

PDB Entry: 3tui, 2.9 Å

PDB Description: Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form

PDB Compounds: (D:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d3tuid1:

Sequence; same for both SEQRES and ATOM records:

>d3tuid1 c.37.1.12 (D:1-240) automated matches {Escherichia coli [TaxId: 83333]}
miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg
svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr
vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsil
ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf

Timeline for d3tuid1:

• d3tuid1 is new in SCOPe 2.03-stable
  
• d3tuid1 appears in SCOPe 2.04
  
• d3tuid1 appears in the current release, SCOPe 2.08