SCOPe 2.05: Domain d1fmd3_: 1fmd 3:

Lineage for d1fmd3_ (1fmd 3:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Aphthovirus (Foot-and-mouth disease virus) coat proteins [49659] (1 species)

7. Species FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId:12110] [49660] (4 PDB entries)

8. Domain d1fmd3_: 1fmd 3: [23374]

Details for d1fmd3_

PDB Entry: 1fmd, 3.5 Å

PDB Description: the structure and antigenicity of a type c foot-and-mouth disease virus

PDB Compounds: (3:) foot-and-mouth disease virus (subunit vp3)

SCOPe Domain Sequences for d1fmd3_:

Sequence; same for both SEQRES and ATOM records:

>d1fmd3_ b.121.4.1 (3:) Aphthovirus (Foot-and-mouth disease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId: 12110]}
gifpvacsdgygnmvttdpktadpaygkvynpprtalpgrftnyldvaeacptflmfenv
pyvstrtdgqrllakfdvslaakhmsntylaglaqyytqytgtinlhfmftgptdakary
mvayvppgmdapdnpeeaahcihaewdtglnskftfsipyisaadytytasheaettcvq
gwvcvyqithgkadadalvvsasagkdfelrlpvdarqq

Timeline for d1fmd3_:

• d1fmd3_ first appeared (with stable ids) in SCOP 1.55
  
• d1fmd3_ appears in SCOPe 2.04
  
• d1fmd3_ appears in SCOPe 2.06
  
• d1fmd3_ appears in the current release, SCOPe 2.08