Lineage for d1fmd3_ (1fmd 3:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11580Protein Foot-and-mouth desease virus [49659] (1 species)
  7. 11581Species Foot-and-mouth disease virus, (strain bfs, 1860) [49660] (4 PDB entries)
  8. 11593Domain d1fmd3_: 1fmd 3: [23374]

Details for d1fmd3_

PDB Entry: 1fmd (more details), 3.5 Å

PDB Description: the structure and antigenicity of a type c foot-and-mouth disease virus

SCOP Domain Sequences for d1fmd3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmd3_ b.10.1.4 (3:) Foot-and-mouth desease virus {Foot-and-mouth disease virus, (strain bfs, 1860)}
gifpvacsdgygnmvttdpktadpaygkvynpprtalpgrftnyldvaeacptflmfenv
pyvstrtdgqrllakfdvslaakhmsntylaglaqyytqytgtinlhfmftgptdakary
mvayvppgmdapdnpeeaahcihaewdtglnskftfsipyisaadytytasheaettcvq
gwvcvyqithgkadadalvvsasagkdfelrlpvdarqq

SCOP Domain Coordinates for d1fmd3_:

Click to download the PDB-style file with coordinates for d1fmd3_.
(The format of our PDB-style files is described here.)

Timeline for d1fmd3_: