![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
![]() | Protein Foot-and-mouth desease virus [49659] (1 species) |
![]() | Species Foot-and-mouth disease virus, (strain bfs, 1860) [49660] (4 PDB entries) |
![]() | Domain d1fmd3_: 1fmd 3: [23374] |
PDB Entry: 1fmd (more details), 3.5 Å
SCOP Domain Sequences for d1fmd3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmd3_ b.10.1.4 (3:) Foot-and-mouth desease virus {Foot-and-mouth disease virus, (strain bfs, 1860)} gifpvacsdgygnmvttdpktadpaygkvynpprtalpgrftnyldvaeacptflmfenv pyvstrtdgqrllakfdvslaakhmsntylaglaqyytqytgtinlhfmftgptdakary mvayvppgmdapdnpeeaahcihaewdtglnskftfsipyisaadytytasheaettcvq gwvcvyqithgkadadalvvsasagkdfelrlpvdarqq
Timeline for d1fmd3_: