SCOPe 2.04: Domain d3ttwa2: 3ttw A:598-753

Lineage for d3ttwa2 (3ttw A:598-753)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186939] (6 PDB entries)

8. Domain d3ttwa2: 3ttw A:598-753 [233738]
   Other proteins in same PDB: d3ttwa1, d3ttwb1, d3ttwc1, d3ttwd1
   automated match to d1p80a1
   complexed with hem

Details for d3ttwa2

PDB Entry: 3ttw, 1.62 Å

PDB Description: Structure of the F413E variant of E. coli KatE

PDB Compounds: (A:) catalase hpii

SCOPe Domain Sequences for d3ttwa2:

Sequence; same for both SEQRES and ATOM records:

>d3ttwa2 c.23.16.0 (A:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d3ttwa2:

• d3ttwa2 first appeared in SCOPe 2.03
  
• d3ttwa2 appears in SCOPe 2.05
  
• d3ttwa2 appears in the current release, SCOPe 2.08