| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (18 species) not a true protein |
| Species Escherichia coli [TaxId:562] [186939] (6 PDB entries) |
| Domain d3ttua2: 3ttu A:598-753 [233730] Other proteins in same PDB: d3ttua1, d3ttub1, d3ttuc1, d3ttud1 automated match to d1p80a1 complexed with hem |
PDB Entry: 3ttu (more details), 1.89 Å
SCOPe Domain Sequences for d3ttua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ttua2 c.23.16.0 (A:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d3ttua2: