Lineage for d3trea2 (3tre A:66-131)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1315558Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1315559Protein automated matches [190576] (18 species)
    not a true protein
  7. 1315584Species Coxiella burnetii [TaxId:777] [233711] (1 PDB entry)
  8. 1315585Domain d3trea2: 3tre A:66-131 [233712]
    Other proteins in same PDB: d3trea1
    automated match to d1ueba2

Details for d3trea2

PDB Entry: 3tre (more details), 2.9 Å

PDB Description: structure of a translation elongation factor p (efp) from coxiella burnetii
PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d3trea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trea2 b.40.4.0 (A:66-131) automated matches {Coxiella burnetii [TaxId: 777]}
dvvevemqylyndgefwhfmtsenyeqhaaskeavaeakqwlkeealcmvtmwngvplsv
eppnfv

SCOPe Domain Coordinates for d3trea2:

Click to download the PDB-style file with coordinates for d3trea2.
(The format of our PDB-style files is described here.)

Timeline for d3trea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3trea1