SCOPe 2.08: Domain d3trea1: 3tre A:3-65

Lineage for d3trea1 (3tre A:3-65)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [233709] (1 PDB entry)

8. Domain d3trea1: 3tre A:3-65 [233710]
   Other proteins in same PDB: d3trea2
   automated match to d1ueba1

Details for d3trea1

PDB Entry: 3tre, 2.9 Å

PDB Description: structure of a translation elongation factor p (efp) from coxiella burnetii

PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d3trea1:

Sequence; same for both SEQRES and ATOM records:

>d3trea1 b.34.5.0 (A:3-65) automated matches {Coxiella burnetii [TaxId: 777]}
thstnefrgglkvmvdgdpcsiidnefvkpgkgqafnrvkfrnlktgrvlertfksgetl
paa

Timeline for d3trea1:

• d3trea1 first appeared in SCOPe 2.03
  
• d3trea1 appears in SCOPe 2.07