| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) ![]() |
| Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
| Protein Vinculin [47224] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries) Uniprot P18206 1-257 |
| Domain d3tj5a2: 3tj5 A:129-255 [233707] automated match to d1rkea2 complexed with gol |
PDB Entry: 3tj5 (more details), 1.99 Å
SCOPe Domain Sequences for d3tj5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tj5a2 a.24.9.1 (A:129-255) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswde
Timeline for d3tj5a2: