| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Bradyrhizobium sp. [TaxId:114615] [233695] (2 PDB entries) |
| Domain d3toyc1: 3toy C:2-132 [233697] Other proteins in same PDB: d3toya2, d3toyb2, d3toyc2, d3toyd2 automated match to d4hncb1 complexed with act, ca, ni, p4c |
PDB Entry: 3toy (more details), 1.8 Å
SCOPe Domain Sequences for d3toyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3toyc1 d.54.1.0 (C:2-132) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
pvvellggsar
Timeline for d3toyc1: