SCOPe 2.05: Domain d3tnya_: 3tny A:

Lineage for d3tnya_ (3tny A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (28 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [233693] (1 PDB entry)

8. Domain d3tnya_: 3tny A: [233694]
   automated match to d3tefa_
   complexed with skz

Details for d3tnya_

PDB Entry: 3tny, 1.55 Å

PDB Description: structure of yfiy from bacillus cereus bound to the siderophore iron (iii) schizokinen

PDB Compounds: (A:) YfiY (ABC transport system substrate-binding protein)

SCOPe Domain Sequences for d3tnya_:

Sequence; same for both SEQRES and ATOM records:

>d3tnya_ c.92.2.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
evvtvehamgktevpanpkrvviltnegteallelgvkpvgavkswtgdpwyphikdkmk
dvkvvgdegqvnvetiaslkpdliignkmrhekvyeqlkaiaptvfsetlrgewkdnfkf
yakalnkekegqkvvadyesrmkdlkgklgdkvnqeismvrfmpgdvriyhgdtfsgvil
kelgfkrpgdqnkddfaernvskerisamdgdvlfyftfdkgnekkgselekeyindplf
knlnavkngkaykvddviwntaggviaanlllddiekrfv

Timeline for d3tnya_:

• d3tnya_ first appeared in SCOPe 2.03
  
• d3tnya_ appears in SCOPe 2.04
  
• d3tnya_ appears in SCOPe 2.06
  
• d3tnya_ appears in the current release, SCOPe 2.08