Lineage for d1fod1_ (1fod 1:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11580Protein Foot-and-mouth desease virus [49659] (1 species)
  7. 11581Species Foot-and-mouth disease virus, (strain bfs, 1860) [49660] (4 PDB entries)
  8. 11588Domain d1fod1_: 1fod 1: [23369]

Details for d1fod1_

PDB Entry: 1fod (more details), 2.6 Å

PDB Description: structure of a major immunogenic site on foot-and-mouth disease virus

SCOP Domain Sequences for d1fod1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fod1_ b.10.1.4 (1:) Foot-and-mouth desease virus {Foot-and-mouth disease virus, (strain bfs, 1860)}
ttsagesadpvtttvenyggetqiqrrqhtdvsfimdrfvkvtpqnqinildlmqvpsht
lvggllrastyyfsdleiavkhegdltwvpngapekaldnttnptayhkapltrlalpyt
aphrvlatvyngecrysrnavpnlrgdlqvlaqkvartlptsfnygaikatrvtellyrm
kraetycprpllaihptearhkqkivapvk

SCOP Domain Coordinates for d1fod1_:

Click to download the PDB-style file with coordinates for d1fod1_.
(The format of our PDB-style files is described here.)

Timeline for d1fod1_: