SCOPe 2.07: Domain d3tj6a1: 3tj6 A:1-128

Lineage for d3tj6a1 (3tj6 A:1-128)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
   Uniprot P18206 1-257

8. Domain d3tj6a1: 3tj6 A:1-128 [233689]
   automated match to d1syqa1

Details for d3tj6a1

PDB Entry: 3tj6, 2.76 Å

PDB Description: human vinculin head domain (vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-vbs-c; residues 812-835) from rickettsia rickettsii

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d3tj6a1:

Sequence, based on SEQRES records:

>d3tj6a1 a.24.9.1 (A:1-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgke
tvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgts
dllltfde

Sequence, based on observed residues (ATOM records):

>d3tj6a1 a.24.9.1 (A:1-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
mpvfhtrtiesilepvaqqishlvimheegkaipdltapvaavqaavsnlvrvgketvqt
tedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsdlll
tfde

Timeline for d3tj6a1:

• d3tj6a1 first appeared in SCOPe 2.03
  
• d3tj6a1 appears in SCOPe 2.06
  
• d3tj6a1 appears in the current release, SCOPe 2.08