Lineage for d3th3l2 (3th3 L:87-142)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2583120Protein automated matches [190092] (2 species)
    not a true protein
  7. 2583121Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)
  8. 2583197Domain d3th3l2: 3th3 L:87-142 [233680]
    Other proteins in same PDB: d3th3h_, d3th3l1, d3th3t1, d3th3t2
    automated match to d1danl2
    complexed with 0ge, bgc, ca, cl, fuc

Details for d3th3l2

PDB Entry: 3th3 (more details), 2.7 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th3l2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d3th3l2:

Click to download the PDB-style file with coordinates for d3th3l2.
(The format of our PDB-style files is described here.)

Timeline for d3th3l2: