SCOPe 2.06: Domain d3tapa1: 3tap A:297-468

Lineage for d3tapa1 (3tap A:297-468)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Geobacillus sp. [TaxId:129337] [233669] (4 PDB entries)

8. Domain d3tapa1: 3tap A:297-468 [233673]
   Other proteins in same PDB: d3tapa2
   automated match to d1nk4a1
   protein/DNA complex; complexed with mg, so4, suc

Details for d3tapa1

PDB Entry: 3tap, 1.66 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-3) position

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3tapa1:

Sequence; same for both SEQRES and ATOM records:

>d3tapa1 c.55.3.0 (A:297-468) automated matches {Geobacillus sp. [TaxId: 129337]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d3tapa1:

• d3tapa1 first appeared in SCOPe 2.03
  
• d3tapa1 appears in SCOPe 2.05
  
• d3tapa1 appears in SCOPe 2.07
  
• d3tapa1 appears in the current release, SCOPe 2.08