Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Foot-and-mouth desease virus [49659] (1 species) |
Species Foot-and-mouth disease virus, (strain bfs, 1860) [49660] (4 PDB entries) |
Domain d1bbt2_: 1bbt 2: [23367] |
PDB Entry: 1bbt (more details), 2.6 Å
SCOP Domain Sequences for d1bbt2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbt2_ b.10.1.4 (2:) Foot-and-mouth desease virus {Foot-and-mouth disease virus, (strain bfs, 1860)} lledrilttrnghttsttqssvgvtygyataedfvsgpntsgletrvvqaerffkthlfd wvtsdsfgrchllelptdhkgvygsltdsyaymrngwdvevtavgnqfnggcllvamvpe lcsiqkrelyqltlfphqfinprtnmtahitvpfvgvnrydqykvhkpwtlvvmvvaplt vntegapqikvyaniaptnvhvagefpske
Timeline for d1bbt2_: