| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
| Protein automated matches [191100] (15 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries) |
| Domain d3t4nc2: 3t4n C:187-322 [233660] Other proteins in same PDB: d3t4na_ automated match to d2ooxe2 complexed with adp |
PDB Entry: 3t4n (more details), 2.3 Å
SCOPe Domain Sequences for d3t4nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t4nc2 d.37.1.0 (C:187-322) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ipigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlgli
kggiyndlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlv
gvltlsdilkyillgs
Timeline for d3t4nc2: