Lineage for d3t4nc1 (3t4n C:8-186)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550519Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2550520Protein automated matches [191100] (15 species)
    not a true protein
  7. 2550544Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233658] (3 PDB entries)
  8. 2550545Domain d3t4nc1: 3t4n C:8-186 [233659]
    Other proteins in same PDB: d3t4na_
    automated match to d2ooxe1
    complexed with adp

Details for d3t4nc1

PDB Entry: 3t4n (more details), 2.3 Å

PDB Description: Structure of the regulatory fragment of Saccharomyces cerevisiae AMPK in complex with ADP
PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d3t4nc1:

Sequence, based on SEQRES records: (download)

>d3t4nc1 d.37.1.0 (C:8-186) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
hpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

Sequence, based on observed residues (ATOM records): (download)

>d3t4nc1 d.37.1.0 (C:8-186) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvtasihpsr
plfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

SCOPe Domain Coordinates for d3t4nc1:

Click to download the PDB-style file with coordinates for d3t4nc1.
(The format of our PDB-style files is described here.)

Timeline for d3t4nc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t4nc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3t4na_