Lineage for d3t06a2 (3t06 A:942-1081)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1550802Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1550973Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [117254] (1 species)
  7. 1550974Species Human (Homo sapiens) [TaxId:9606] [117255] (3 PDB entries)
    Uniprot O15085 714-1081
  8. 1550979Domain d3t06a2: 3t06 A:942-1081 [233655]
    Other proteins in same PDB: d3t06a1, d3t06b_, d3t06e1, d3t06f_
    automated match to d1xcga2

Details for d3t06a2

PDB Entry: 3t06 (more details), 2.84 Å

PDB Description: crystal structure of the dh/ph fragment of pdzrhogef with n-terminal regulatory elements in complex with human rhoa
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d3t06a2:

Sequence, based on SEQRES records: (download)

>d3t06a2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktavgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelva
ltssdkntwmelleeavrna

Sequence, based on observed residues (ATOM records): (download)

>d3t06a2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkctfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwmell
eeavrna

SCOPe Domain Coordinates for d3t06a2:

Click to download the PDB-style file with coordinates for d3t06a2.
(The format of our PDB-style files is described here.)

Timeline for d3t06a2: