Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries) |
Domain d3t04d_: 3t04 D: [233653] Other proteins in same PDB: d3t04a_ automated match to d2ck2a_ complexed with gol, so4 |
PDB Entry: 3t04 (more details), 2.1 Å
SCOPe Domain Sequences for d3t04d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t04d_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggsgssvssvptklevvdatptslkiswdayysswqnvkyyritygetggdspvqeftvp gyystatisglkpgvdytitvyaydtffpgyepnspisinyrt
Timeline for d3t04d_: