SCOPe 2.08: Domain d3t04d1: 3t04 D:6-103

Lineage for d3t04d1 (3t04 D:6-103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d3t04d1: 3t04 D:6-103 [233653]
   Other proteins in same PDB: d3t04a_, d3t04d2
   automated match to d2ck2a_
   complexed with gol, so4

Details for d3t04d1

PDB Entry: 3t04, 2.1 Å

PDB Description: Crystal structure of monobody 7c12/abl1 sh2 domain complex

PDB Compounds: (D:) monobody 7c12

SCOPe Domain Sequences for d3t04d1:

Sequence; same for both SEQRES and ATOM records:

>d3t04d1 b.1.2.0 (D:6-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvdatptslkiswdayysswqnvkyyritygetggdspvqeftvpgyyst
atisglkpgvdytitvyaydtffpgyepnspisinyrt

Timeline for d3t04d1:

• d3t04d1 first appeared in SCOPe 2.03, called d3t04d_
  
• d3t04d1 appears in SCOPe 2.07