Lineage for d3t04d1 (3t04 D:6-103)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (56 PDB entries)
  8. 2359533Domain d3t04d1: 3t04 D:6-103 [233653]
    Other proteins in same PDB: d3t04a_, d3t04d2
    automated match to d2ck2a_
    complexed with gol, so4

Details for d3t04d1

PDB Entry: 3t04 (more details), 2.1 Å

PDB Description: Crystal structure of monobody 7c12/abl1 sh2 domain complex
PDB Compounds: (D:) monobody 7c12

SCOPe Domain Sequences for d3t04d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t04d1 b.1.2.0 (D:6-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvdatptslkiswdayysswqnvkyyritygetggdspvqeftvpgyyst
atisglkpgvdytitvyaydtffpgyepnspisinyrt

SCOPe Domain Coordinates for d3t04d1:

Click to download the PDB-style file with coordinates for d3t04d1.
(The format of our PDB-style files is described here.)

Timeline for d3t04d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t04d2
View in 3D
Domains from other chains:
(mouse over for more information)
d3t04a_