Lineage for d3sxtf_ (3sxt F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326994Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1327013Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1327065Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 1327066Protein automated matches [232762] (1 species)
    not a true protein
  7. 1327067Species Paracoccus denitrificans [TaxId:318586] [232763] (13 PDB entries)
  8. 1327073Domain d3sxtf_: 3sxt F: [233652]
    Other proteins in same PDB: d3sxtc_, d3sxte_
    automated match to d2madh_
    complexed with ca, edo, hec, na

Details for d3sxtf_

PDB Entry: 3sxt (more details), 1.81 Å

PDB Description: Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
PDB Compounds: (F:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3sxtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxtf_ b.69.2.0 (F:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

SCOPe Domain Coordinates for d3sxtf_:

Click to download the PDB-style file with coordinates for d3sxtf_.
(The format of our PDB-style files is described here.)

Timeline for d3sxtf_: