SCOPe 2.03: Domain d3sxtd_: 3sxt D:

Lineage for d3sxtd_ (3sxt D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families)

5. Family b.69.2.0: automated matches [232760] (1 protein)
   not a true family

6. Protein automated matches [232762] (1 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [232763] (13 PDB entries)

8. Domain d3sxtd_: 3sxt D: [233651]
   Other proteins in same PDB: d3sxtc_, d3sxte_
   automated match to d2madh_
   complexed with ca, edo, hec, na

Details for d3sxtd_

PDB Entry: 3sxt, 1.81 Å

PDB Description: Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG

PDB Compounds: (D:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3sxtd_:

Sequence; same for both SEQRES and ATOM records:

>d3sxtd_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
etqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrv
igmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdap
rflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdt
ffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihq
idlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasr
fvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvn
qlghgpqvittadmg

Timeline for d3sxtd_:

• d3sxtd_ is new in SCOPe 2.03-stable
  
• d3sxtd_ appears in SCOPe 2.04
  
• d3sxtd_ appears in the current release, SCOPe 2.08