Lineage for d3swsf_ (3sws F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065850Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2065886Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2065887Protein automated matches [232762] (1 species)
    not a true protein
  7. 2065888Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2065898Domain d3swsf_: 3sws F: [233650]
    Other proteins in same PDB: d3swsc1, d3swsc2, d3swse_
    automated match to d2madh_
    complexed with 1pe, act, ca, edo, hec, mes, na, pg4

Details for d3swsf_

PDB Entry: 3sws (more details), 1.86 Å

PDB Description: Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG
PDB Compounds: (F:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3swsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swsf_ b.69.2.0 (F:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

SCOPe Domain Coordinates for d3swsf_:

Click to download the PDB-style file with coordinates for d3swsf_.
(The format of our PDB-style files is described here.)

Timeline for d3swsf_: