Lineage for d3svla_ (3svl A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465218Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries)
  8. 2465227Domain d3svla_: 3svl A: [233645]
    automated match to d3u7ra_
    complexed with ca, fmn

Details for d3svla_

PDB Entry: 3svl (more details), 2.2 Å

PDB Description: Structural basis of the improvement of ChrR - a multi-purpose enzyme
PDB Compounds: (A:) protein yieF

SCOPe Domain Sequences for d3svla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svla_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klqvvtllgslrkgsfngmvartlpkiapasmevnalpsiadiplydadvqqeegfpatv
ealaeqirqadgvvivtpeynysvpgglknaidwlsrlpdqplagkpvliqtssmgvigg
arcqyhlrqilvfldamvmnkpefmggviqnkvdpqtgevidqgtldhltgqltafgefi
q

SCOPe Domain Coordinates for d3svla_:

Click to download the PDB-style file with coordinates for d3svla_.
(The format of our PDB-style files is described here.)

Timeline for d3svla_: