Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (31 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries) |
Domain d3svla_: 3svl A: [233645] automated match to d3u7ra_ complexed with ca, fmn |
PDB Entry: 3svl (more details), 2.2 Å
SCOPe Domain Sequences for d3svla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3svla_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} klqvvtllgslrkgsfngmvartlpkiapasmevnalpsiadiplydadvqqeegfpatv ealaeqirqadgvvivtpeynysvpgglknaidwlsrlpdqplagkpvliqtssmgvigg arcqyhlrqilvfldamvmnkpefmggviqnkvdpqtgevidqgtldhltgqltafgefi q
Timeline for d3svla_: