SCOPe 2.08: Domain d3svla_: 3svl A:

Lineage for d3svla_ (3svl A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries)

8. Domain d3svla_: 3svl A: [233645]
   automated match to d3u7ra_
   complexed with ca, fmn

Details for d3svla_

PDB Entry: 3svl, 2.2 Å

PDB Description: Structural basis of the improvement of ChrR - a multi-purpose enzyme

PDB Compounds: (A:) protein yieF

SCOPe Domain Sequences for d3svla_:

Sequence; same for both SEQRES and ATOM records:

>d3svla_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klqvvtllgslrkgsfngmvartlpkiapasmevnalpsiadiplydadvqqeegfpatv
ealaeqirqadgvvivtpeynysvpgglknaidwlsrlpdqplagkpvliqtssmgvigg
arcqyhlrqilvfldamvmnkpefmggviqnkvdpqtgevidqgtldhltgqltafgefi
q

Timeline for d3svla_:

• d3svla_ first appeared in SCOPe 2.03
  
• d3svla_ appears in SCOPe 2.07