SCOPe 2.08: Domain d3sv6a1: 3sv6 A:986-1181

Lineage for d3sv6a1 (3sv6 A:986-1181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries)

8. Domain d3sv6a1: 3sv6 A:986-1181 [233642]
   Other proteins in same PDB: d3sv6a2
   automated match to d3sv8a_
   complexed with gol, so4, sv6, zn

Details for d3sv6a1

PDB Entry: 3sv6, 1.4 Å

PDB Description: crystal structure of ns3/4a protease in complex with telaprevir

PDB Compounds: (A:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3sv6a1:

Sequence; same for both SEQRES and ATOM records:

>d3sv6a1 b.47.1.3 (A:986-1181) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
mkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtfla
tsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstrgvak
avdfipveslettmrs

Timeline for d3sv6a1:

• d3sv6a1 first appeared in SCOPe 2.03, called d3sv6a_
  
• d3sv6a1 appears in SCOPe 2.07