SCOPe 2.08: Domain d3su1a1: 3su1 A:986-1180

Lineage for d3su1a1 (3su1 A:986-1180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries)

8. Domain d3su1a1: 3su1 A:986-1180 [233632]
   Other proteins in same PDB: d3su1a2
   automated match to d3sv8a_
   complexed with so4, tsv, zn

Details for d3su1a1

PDB Entry: 3su1, 1.4 Å

PDB Description: crystal structure of ns3/4a protease variant d168a in complex with danoprevir

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d3su1a1:

Sequence; same for both SEQRES and ATOM records:

>d3su1a1 b.47.1.3 (A:986-1180) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
mkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtfla
tsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvak
avafipveslettmr

Timeline for d3su1a1:

• d3su1a1 first appeared in SCOPe 2.03, called d3su1a_
  
• d3su1a1 appears in SCOPe 2.07