| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
| Protein automated matches [190252] (5 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [233617] (1 PDB entry) |
| Domain d3sr9a2: 3sr9 A:1656-1901 [233619] automated match to d1lara2 |
PDB Entry: 3sr9 (more details), 2.4 Å
SCOPe Domain Sequences for d3sr9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sr9a2 c.45.1.2 (A:1656-1901) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fitaslpcnkfknrlvnilpyessrvclqpirgvegsdyinasfidgyrqqkayiatqgp
laettedfwralwennstivvmltklremgrekchqywpaersaryqyfvvdpmaeynmp
qyilrefkvtdardgqsrtvrqfqftdwpeqgapksgegfidfigqvhktkeqfgqdgpi
svhcsagvgrtgvfitlsivlermryegvvdifqtvkvlrtqrpamvqtedeyqfcfqaa
leylgs
Timeline for d3sr9a2: