SCOPe 2.05: Domain d3sr9a1: 3sr9 A:1326-1647

Lineage for d3sr9a1 (3sr9 A:1326-1647)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [233617] (1 PDB entry)

8. Domain d3sr9a1: 3sr9 A:1326-1647 [233618]
   automated match to d1lara1

Details for d3sr9a1

PDB Entry: 3sr9, 2.4 Å

PDB Description: Crystal structure of mouse PTPsigma

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase S

SCOPe Domain Sequences for d3sr9a1:

Sequence; same for both SEQRES and ATOM records:

>d3sr9a1 c.45.1.2 (A:1326-1647) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mlshppipitdmaehmerlkandslklsqeyesidpgqqftwehsnleankpknryanvi
aydhsrvilqplegimgsdyinanyvdgyrrqnayiatqgplpetfgdfwrmvweqrsat
vvmmtrleeksrikcdqywpnrgtetygfiqvtlldtmelatfcvrtfslhkngssekre
vrhfqftawpdhgvpeyptpflaflrrvktcnppdagpivvhcsagvgrtgcfividaml
eriktektvdvyghvtlmrsqrnymvqtedqygfihealleavgcgntevparslytyiq
klaqvepgehvtgmelefkrla

Timeline for d3sr9a1:

• d3sr9a1 first appeared in SCOPe 2.03
  
• d3sr9a1 appears in SCOPe 2.04
  
• d3sr9a1 appears in SCOPe 2.06
  
• d3sr9a1 appears in the current release, SCOPe 2.08