Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
Protein automated matches [230465] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries) |
Domain d3sr6l1: 3sr6 L:571-694 [233615] Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c2, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l2 automated match to d1v97a3 complexed with fad, fes, mte, rmo |
PDB Entry: 3sr6 (more details), 2.1 Å
SCOPe Domain Sequences for d3sr6l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sr6l1 d.41.1.0 (L:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]} dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye dlpa
Timeline for d3sr6l1: