Lineage for d3sr6c1 (3sr6 C:571-694)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410866Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1410867Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1410946Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 1410947Protein automated matches [230465] (2 species)
    not a true protein
  7. 1410948Species Bos taurus [TaxId:9913] [232071] (4 PDB entries)
  8. 1410951Domain d3sr6c1: 3sr6 C:571-694 [233613]
    Other proteins in same PDB: d3sr6c2, d3sr6l2
    automated match to d1v97a3
    complexed with fad, fes, mte, rmo

Details for d3sr6c1

PDB Entry: 3sr6 (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (C:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr6c1 d.41.1.0 (C:571-694) automated matches {Bos taurus [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3sr6c1:

Click to download the PDB-style file with coordinates for d3sr6c1.
(The format of our PDB-style files is described here.)

Timeline for d3sr6c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sr6c2