Lineage for d3spza1 (3spz A:1-375)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139729Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2139741Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2139742Species Bacteriophage RB69 [TaxId:12353] [53127] (92 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 2139798Domain d3spza1: 3spz A:1-375 [233591]
    Other proteins in same PDB: d3spza2
    automated match to d1ih7a1
    protein/DNA complex; complexed with ca, upc

Details for d3spza1

PDB Entry: 3spz (more details), 2.43 Å

PDB Description: dna polymerase(l415a/l561a/s565g/y567a) ternary complex with dupcpp opposite da (ca2+)
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3spza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3spza1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOPe Domain Coordinates for d3spza1:

Click to download the PDB-style file with coordinates for d3spza1.
(The format of our PDB-style files is described here.)

Timeline for d3spza1: