SCOPe 2.08: Domain d3smpa2: 3smp A:382-593

Lineage for d3smpa2 (3smp A:382-593)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (6 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein Pantothenate kinase 1, PANK1, C-terminal domain [418999] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419471] (2 PDB entries)
   Uniprot Q8TE04

8. Domain d3smpa2: 3smp A:382-593 [233588]
   Other proteins in same PDB: d3smpa1, d3smpb1
   automated match to d2i7na2
   complexed with aco, ars, cl, unx
   has additional insertions and/or extensions that are not grouped together

Details for d3smpa2

PDB Entry: 3smp, 1.9 Å

PDB Description: Monoclinic crystal structure of human pantothenate kinase 1 alpha

PDB Compounds: (A:) Pantothenate kinase 1

SCOPe Domain Sequences for d3smpa2:

Sequence, based on SEQRES records:

>d3smpa2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpecyyfenptnpelcqkkpycldnpypmllvnmgsgvsilavyskdnykrvtgtslggg
tflglcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmm
skekrdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllay
amdfwskgqlkalflehegyfgavgallelfk

Sequence, based on observed residues (ATOM records):

>d3smpa2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpecyyfenptnpelcqkkpycpypmllvnmgsgvsilavyskdnykrvtgtslgggtfl
glcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmmske
krdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllayamd
fwskgqlkalflehegyfgavgallelfk

Timeline for d3smpa2:

• d3smpa2 first appeared in SCOPe 2.03
  
• d3smpa2 appears in SCOPe 2.07