SCOPe 2.03: Domain d3soka_: 3sok A:

Lineage for d3soka_ (3sok A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.0: automated matches [233575] (1 protein)
   not a true family

6. Protein automated matches [233576] (1 species)
   not a true protein

7. Species Dichelobacter nodosus [TaxId:870] [233578] (1 PDB entry)

8. Domain d3soka_: 3sok A: [233580]
   automated match to d1oqwa_

Details for d3soka_

PDB Entry: 3sok, 2.3 Å

PDB Description: Dichelobacter nodosus pilin FimA

PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d3soka_:

Sequence; same for both SEQRES and ATOM records:

>d3soka_ d.24.1.0 (A:) automated matches {Dichelobacter nodosus [TaxId: 870]}
ftlielmivvaiigilaafaipayndyiarsqaaegltladglkvrisdhlesgeckgda
npasgslgnddkgkyalatidgdynkdaktadekngckvvitygqgtagekisklivgkk
lvldqfvngsykynegetdlelkfipnavkn

Timeline for d3soka_:

• d3soka_ is new in SCOPe 2.03-stable
  
• d3soka_ appears in SCOPe 2.04
  
• d3soka_ appears in the current release, SCOPe 2.08