Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.0: automated matches [233575] (1 protein) not a true family |
Protein automated matches [233576] (1 species) not a true protein |
Species Dichelobacter nodosus [TaxId:870] [233578] (1 PDB entry) |
Domain d3soka_: 3sok A: [233580] automated match to d1oqwa_ |
PDB Entry: 3sok (more details), 2.3 Å
SCOPe Domain Sequences for d3soka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3soka_ d.24.1.0 (A:) automated matches {Dichelobacter nodosus [TaxId: 870]} ftlielmivvaiigilaafaipayndyiarsqaaegltladglkvrisdhlesgeckgda npasgslgnddkgkyalatidgdynkdaktadekngckvvitygqgtagekisklivgkk lvldqfvngsykynegetdlelkfipnavkn
Timeline for d3soka_: