Lineage for d3soka_ (3sok A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941295Family d.24.1.0: automated matches [233575] (1 protein)
    not a true family
  6. 2941296Protein automated matches [233576] (3 species)
    not a true protein
  7. 2941297Species Dichelobacter nodosus [TaxId:870] [233578] (1 PDB entry)
  8. 2941298Domain d3soka_: 3sok A: [233580]
    automated match to d1oqwa_

Details for d3soka_

PDB Entry: 3sok (more details), 2.3 Å

PDB Description: Dichelobacter nodosus pilin FimA
PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d3soka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3soka_ d.24.1.0 (A:) automated matches {Dichelobacter nodosus [TaxId: 870]}
ftlielmivvaiigilaafaipayndyiarsqaaegltladglkvrisdhlesgeckgda
npasgslgnddkgkyalatidgdynkdaktadekngckvvitygqgtagekisklivgkk
lvldqfvngsykynegetdlelkfipnavkn

SCOPe Domain Coordinates for d3soka_:

Click to download the PDB-style file with coordinates for d3soka_.
(The format of our PDB-style files is described here.)

Timeline for d3soka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3sokb_