SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1sieb_ (1sie B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076458Family b.121.6.1: Papovaviridae-like VP [88649] (3 protein domains)
  6. 2076462Protein Polyomavirus coat proteins [49657] (2 species)
  7. 2076463Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries)
  8. 2076516Domain d1sieb_: 1sie B: [23358]

Details for d1sieb_

PDB Entry: 1sie (more details), 3.65 Å

PDB Description: murine polyomavirus complexed with a disialylated oligosaccharide
PDB Compounds: (B:) polyomavirus coat protein vp1

SCOPe Domain Sequences for d1sieb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sieb_ b.121.6.1 (B:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt
ktvfpgn

SCOPe Domain Coordinates for d1sieb_:

Click to download the PDB-style file with coordinates for d1sieb_.
(The format of our PDB-style files is described here.)

Timeline for d1sieb_: