Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
Protein automated matches [191267] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189837] (16 PDB entries) |
Domain d3so8a_: 3so8 A: [233574] automated match to d1bd8a_ |
PDB Entry: 3so8 (more details), 1.9 Å
SCOPe Domain Sequences for d3so8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3so8a_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nslsvhqlaaqgemlylatrieqenvinhtdeegftplmwaaahgqiavvefllqngadp qllgkgresalslacskgytdivkmlldcgvdvneydwnggtpllyavhgnhvkcvkmll esgadptietdsgynsmdlavalgyrsvqqvieshllkllqn
Timeline for d3so8a_: